PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_5372_f_10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family HD-ZIP
Protein Properties Length: 262aa    MW: 29220.1 Da    PI: 7.9923
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_5372_f_10genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.75.6e-20117171256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ ++tkeq  +Lee F++++++s ++++ LA+kl+L  rqV vWFqNrRa+ k
  Neem_5372_f_10 117 RKKLRLTKEQFATLEESFKEHSTLSPKQKQALAEKLHLRPRQVEVWFQNRRARTK 171
                     78889************************************************98 PP

2HD-ZIP_I/II122.62e-39117205190
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                     +kk+rl+keq ++LEesF+e+++L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e Lkr++++l+een+rL+ke +eL+ +
  Neem_5372_f_10 117 RKKLRLTKEQFATLEESFKEHSTLSPKQKQALAEKLHLRPRQVEVWFQNRRARTKLKQTEVDCELLKRCCETLTEENKRLQKELQELK-S 205
                     69*************************************************************************************9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-18109167IPR009057Homeodomain-like
PROSITE profilePS5007117.572113173IPR001356Homeobox domain
SuperFamilySSF466891.88E-18114181IPR009057Homeodomain-like
SMARTSM003891.3E-16115177IPR001356Homeobox domain
CDDcd000869.65E-17116174No hitNo description
PfamPF000462.1E-17117171IPR001356Homeobox domain
PROSITE patternPS000270148171IPR017970Homeobox, conserved site
PfamPF021831.3E-9173206IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.4E-22173216IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MEFDDVCNTG LDLGITTLPK TGHQLKKKKL SLKYDHLLPS LTLGPSEDML KSATKNDVAG  60
KVCESTDVHQ QASSMSAVSS FSNTSVKKER DVGDEEVELE RVSNSRISDE DEDGSPRKKL  120
RLTKEQFATL EESFKEHSTL SPKQKQALAE KLHLRPRQVE VWFQNRRART KLKQTEVDCE  180
LLKRCCETLT EENKRLQKEL QELKSLKLSA PLYMKLPAAT LTLCPSCERL GSGGDGSTTN  240
SSFTFGPKSL YNSFTNPSAA SC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1165173RRARTKLKQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6013341e-148JX601334.1 Gossypium hirsutum clone NBRI_GE39498 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007018400.11e-115HD domain class transcription factor
SwissprotP466042e-81HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLA0A061FE721e-115A0A061FE72_THECC; HD domain class transcription factor
STRINGVIT_00s0732g00010.t011e-106(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16712886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.12e-69HD-ZIP family protein